PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g04200.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 260aa    MW: 29231 Da    PI: 8.9268
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g04200.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.52.1e-29959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a+iifs +g+lyeys+
  Zjn_sc00009.1.g04200.1.sm.mk  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALIIFSGRGRLYEYSN 59
                                  79***********************************************95 PP

2K-box104.71.1e-34831749100
                         K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                                    + + +++ qqe++kL+++i++Lq+++ hl+G+++++++ keL++Le++Le+++ +iRskK++ll+++ie++qk+e +lq+
  Zjn_sc00009.1.g04200.1.sm.mk  83 IDVNSHQYFQQEATKLRQQIQTLQNSNMHLMGDSIGNMTAKELKNLESRLERGIGRIRSKKHDLLFAEIEYMQKREADLQN 163
                                   566889*************************************************************************** PP

                         K-box  90 enkaLrkklee 100
                                   en +Lr+k++e
  Zjn_sc00009.1.g04200.1.sm.mk 164 ENLYLRAKIAE 174
                                   ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.151161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-31274IPR002100Transcription factor, MADS-box
CDDcd002653.04E-45275No hitNo description
PRINTSPR004041.8E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2785172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.21188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALIIFSG RGRLYEYSNN  60
SIRSTIERYK KASASTSGSA PVIDVNSHQY FQQEATKLRQ QIQTLQNSNM HLMGDSIGNM  120
TAKELKNLES RLERGIGRIR SKKHDLLFAE IEYMQKREAD LQNENLYLRA KIAEADRVQQ  180
QAAAEEQEMV PVTTELHALP ASFDPRGYYQ QQVSMLTAAA SASSSQYAEH PEVGQKHQQT  240
ALHLGYHLNV DAAAAGEGLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q9e-20173173Myocyte-specific enhancer factor 2B
1tqe_R9e-20173173Myocyte-specific enhancer factor 2B
1tqe_S9e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.11e-143PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.11e-143PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-131MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLK3XKX81e-143K3XKX8_SETIT; Uncharacterized protein
STRINGSi002551m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.14e-89MIKC_MADS family protein